PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10013453m
Common NameCICLE_v10013453mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family G2-like
Protein Properties Length: 254aa    MW: 28464 Da    PI: 8.6272
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10013453mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.51.1e-311569155
          G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                     k+rlrWt+eLH rF eav+qLGG+++AtPk il++m+v+gLt++hvkSHLQkYR+
  Ciclev10013453m 15 KERLRWTQELHYRFEEAVNQLGGPDRATPKGILKAMGVPGLTIYHVKSHLQKYRI 69
                     68****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.4971272IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.5E-301370IPR009057Homeodomain-like
SuperFamilySSF466894.84E-181469IPR009057Homeodomain-like
TIGRFAMsTIGR015572.7E-241570IPR006447Myb domain, plants
PfamPF002491.1E-91768IPR001005SANT/Myb domain
PfamPF143792.8E-15100144IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
PDSDMGSNRS DGSGKERLRW TQELHYRFEE AVNQLGGPDR ATPKGILKAM GVPGLTIYHV  60
KSHLQKYRIS KYIPEIGPSK FERRSISDML PNFGTTSAAQ LNEALQMQTD VYRRMSDHVE  120
VQRNLKLKIE AQGRFLDRIV KDHKNRATPN TKSGKPYSPV SLPALCEETE SNAKDFESDS  180
EADKNEIESG EGIRALKRLR VEDDTLPPMF RVSSLSPNSY NRDIQAKASY PAQDISFPWS  240
FAACSSPLVP SFL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006429402.10.0hypothetical protein CICLE_v10013453mg, partial
TrEMBLV4SPR10.0V4SPR1_9R
STRINGPOPTR_0006s10190.11e-114(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM168021011
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.13e-51G2-like family protein